PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00037124-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 664aa    MW: 73880.1 Da    PI: 4.9372
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00037124-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS434.67.3e-1332936642374
              GRAS   2 velLlecAeavss..gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                       +elL++cA+av++  +d  ++++l+a+l++ +s  g+pmqRl ay++e++ arla+s+s +yk+l+++e +   s e l+++++++ev+P++k
  PSME_00037124-RA 293 KELLIACAKAVADsaNDSVKIDKLIAELRQVVSVCGEPMQRLGAYMVEGIVARLASSGSIIYKSLRCKEPT---SPELLSYMQVLFEVCPYFK 382
                       689********9843555699*************************************************9...9****************** PP

              GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                       f++++aN aI ea++ e+rvHiiDf+i qG QW++L+qaLa+Rp+gpp++ iTg+++p s+  +   le +g+rL+k+Ae ++vpfef++ v 
  PSME_00037124-RA 383 FGYMAANGAIAEAFKDEDRVHIIDFQIAQGSQWVTLIQALAARPRGPPHVCITGIDDPVSQyaRGGGLELVGKRLSKLAEICNVPFEFRP-VP 474
                       **********************************************************99999999************************.68 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                          +d+++++L+++ g+alaVn+++qlh+++desv+++++rd++L++vk+l Pkv+++veqe+++n+++Fl rf+e+l+yysa+f+sl+++lp
  PSME_00037124-RA 475 VMGTDVQVNMLKCEAGDALAVNFSFQLHHMPDESVNTSNHRDRLLRMVKGLAPKVLTIVEQESNTNTAPFLLRFMETLSYYSAIFESLDVTLP 567
                       8999***************************************************************************************** PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s+eri+vE+++l+r+ivn++acegaer+erhe ++kW++rl++aGFkp+pls+ +++++k+ll+ + ++ y++ e++++l+lgW +rpL++
  PSME_00037124-RA 568 RDSKERINVEEHCLARDIVNIIACEGAERIERHELMGKWKSRLTMAGFKPYPLSSIVNSTIKSLLEGYCQK-YSLLERDDTLYLGWLNRPLIA 659
                       *********************************************************************66.********************* PP

              GRAS 370 vSaWr 374
                       +SaW+
  PSME_00037124-RA 660 ASAWQ 664
                       ****6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.956266645IPR005202Transcription factor GRAS
PfamPF035142.5E-130293664IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005829Cellular Componentcytosol
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MNVQFKTEVV AAGQNSQYVL GHPHKTFGTC LPDPGPSIAS NMSHEQASGS HEWIHGTPKT  60
SYQNFPCSPQ EDISYGLGHS TRTHECYRSD KYRLSDGSVQ SSPLHDNDSL QSQRSTHEAL  120
PYSTGHSFYS SPSVQSCSSS GSPASPQVSQ NYPSGLHYFH SPLEPYGLAG SGYSGTEQEE  180
DLKYMLQELE TALLVSESDD PDNFGSAYEE HRFPEYSEWN FEAMHDTTDN YCQSSLSVYP  240
KPEQVEVSSM TMNHVKVEIV NEVDLGIVCS STINASEERK EELEFDIPYG DVKELLIACA  300
KAVADSANDS VKIDKLIAEL RQVVSVCGEP MQRLGAYMVE GIVARLASSG SIIYKSLRCK  360
EPTSPELLSY MQVLFEVCPY FKFGYMAANG AIAEAFKDED RVHIIDFQIA QGSQWVTLIQ  420
ALAARPRGPP HVCITGIDDP VSQYARGGGL ELVGKRLSKL AEICNVPFEF RPVPVMGTDV  480
QVNMLKCEAG DALAVNFSFQ LHHMPDESVN TSNHRDRLLR MVKGLAPKVL TIVEQESNTN  540
TAPFLLRFME TLSYYSAIFE SLDVTLPRDS KERINVEEHC LARDIVNIIA CEGAERIERH  600
ELMGKWKSRL TMAGFKPYPL SSIVNSTIKS LLEGYCQKYS LLERDDTLYL GWLNRPLIAA  660
SAWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-612966648375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1153410.0BT115341.1 Picea glauca clone GQ03614_J13 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006836764.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0D6QZI20.0A0A0D6QZI2_ARACU; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein